PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_50CECDF43.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 321aa    MW: 35424.3 Da    PI: 6.5947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_50CECDF43.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-141462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W++eEd  l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
  Traes_1AL_50CECDF43.1 14 RGPWSPEEDAMLKAYIEERGTGnNWIALPHKIGLKRCGKSCRLRWLNYL 62
                           89*********************************************97 PP

2Myb_DNA-binding40.27.9e-1369111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T+eEd  + ++    G++ W+ Ia+ ++ gRt++++k++w++
  Traes_1AL_50CECDF43.1  69 GDFTPEEDSTICKLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111
                            789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.957962IPR017930Myb domain
SuperFamilySSF466895.31E-2612109IPR009057Homeodomain-like
SMARTSM007171.3E-101364IPR001005SANT/Myb domain
PfamPF002493.2E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231569IPR009057Homeodomain-like
CDDcd001674.20E-81662No hitNo description
PROSITE profilePS5129421.52163117IPR017930Myb domain
SMARTSM007171.2E-1167115IPR001005SANT/Myb domain
PfamPF002492.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2370117IPR009057Homeodomain-like
CDDcd001675.53E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRAPCCDKA TVKRGPWSPE EDAMLKAYIE ERGTGNNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTPEEDSTIC KLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLLGG  120
RRKDRGASTQ QHRQGELDGA NNDGEQQPLS ASAMERIQLC MQLQEMQNPL SSIGNHNNPL  180
HLWQPGSHHQ IAATYSNNSN NNSNSSRSSS LDVTVAAEQG QSSSLNDQHL GGQQQLEMAA  240
AADGLASPSS AGNSNMVTIE AELQELLYST TTTTTTDSVV TQQGGVDWWS YDQGKSPVHC  300
WDFAPETSSV LQDYAAVVYD M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A3e-23141282124MYB3
3zqc_D3e-23141282124MYB3
3zqc_G3e-23141282124MYB3
3zqc_J3e-23141282124MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573606.11e-164PREDICTED: transcription factor RAX3
SwissprotQ9FKL24e-84MYB36_ARATH; Transcription factor MYB36
TrEMBLW4ZP520.0W4ZP52_WHEAT; Uncharacterized protein
STRINGMLOC_56989.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-76myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]